LL-37 – 5mg Antimicrobial Peptide

$45.00

LL-37 (Cathelicidin Antimicrobial Peptide) – Lyophilized Powder

  • Purity: >99.0% (Verified via HPLC & Mass Spectrometry)

  • Form: Lyophilized Solid Powder

  • Quantity: 5mg Total

  • Sequence: [LL-37, 37 aa]

  • Application: In-vitro antimicrobial assays, biofilm disruption, endotoxin neutralization, and immune modulation models.

  • Disclaimer: Strictly for in-vitro laboratory research and analytical purposes. Not for human or veterinary use.

- +
SKU: ION-LL37-5 Category:
Guaranteed Safe Checkout

Comprehensive Laboratory Profile

The acquisition of high-potency, targeted antimicrobial peptides provides institutional laboratories with the advanced capability to observe cellular defense mechanisms and pathogen neutralization in real-time.

By integrating the LL-37 5mg peptide into institutional protocols, researchers gain access to a highly purified formulation. This specific compound is engineered to simulate the aggressive antimicrobial and immunomodulatory phases of the innate immune response.

Synthesized in the USA to the most rigorous industry standards, this specialized complex delivers absolute analytical precision. Utilizing the LL-37 5mg formulation ensures your laboratory acquires reproducible data, free from the performance variability of improperly isolated research materials.

Biochemical Profile: Cathelicidin Defense

The LL-37 formulation is a synthetically produced 37-amino acid peptide that represents the only cathelicidin-derived antimicrobial peptide found in humans. It is highly valued in the scientific community for its amphipathic, alpha-helical structure, which allows it to seamlessly interact with and disrupt lipid bilayers.

By introducing the LL-37 5mg matrix into an in-vitro environment, researchers can evaluate the targeted destruction of pathogenic cell membranes. This highly specific signaling profile is critical for studies focusing on how cellular structures neutralize both Gram-positive and Gram-negative bacteria without inducing extensive damage to host cells.

Mechanism of Action in Cellular Assays

When introduced to cellular monolayers or isolated bacterial cultures, the LL-37 5mg compound functions as a synchronized defensive trigger. It actively binds to the lipopolysaccharides (LPS) on the outer membranes of pathogens, leading to rapid transmembrane pore formation and subsequent pathogen lysis.

Simultaneously, it initiates the transcription of crucial chemokines and structural proteins necessary for localized immune signaling. By deploying this formulation, laboratories can document the aggressive stimulation of the innate immune response and cellular repair phase.

This allows researchers to establish highly stable micro-environments where the rapid neutralization of endotoxins and biofilms can be monitored with total scientific clarity.

Primary In-Vitro Research Applications

The exceptional purity and targeted structural design of this peptide make it a cornerstone for advanced immunological and antimicrobial R&D:

  • Antimicrobial Assays: Mapping the kinetic response and lysis rates of bacterial cultures exposed to alpha-helical peptides.

  • Biofilm Disruption Studies: Evaluating the precise activation rates of matrix degradation in antibiotic-resistant pathogen models.

  • Endotoxin Neutralization: Utilizing the LL-37 5mg complex to monitor cellular recovery and cytokine suppression following exposure to LPS.

  • Immune Modulation R&D: Using this specific sequence to establish standardized laboratory models for comparative efficacy testing against traditional antibiotic agents.

Absolute Purity and Quality Assurance

At Ion Peptides, we recognize that anomalous data caused by degraded or under-dosed materials critically jeopardizes institutional research funding.

Every single batch of our LL-37 5mg peptide is subjected to uncompromising third-party analytical testing before being approved for acquisition. We utilize High-Performance Liquid Chromatography (HPLC) to verify a purity threshold of >99.0%.

Furthermore, rigorous Mass Spectrometry (MS) confirms the precise structural sequence and integrity of the complex. By securing your supply through our secure USA synthesis network and encrypted crypto gateways, you guarantee your facility receives elite, uncompromised materials.

Lyophilization, Storage, and Reconstitution Protocols

To ensure maximum molecular stability during secure domestic transit, the LL-37 5mg vial is supplied as a lyophilized (freeze-dried) solid powder.

  • Storage: Keep vials in a climate-controlled, dark environment, ideally at or below -20°C. Protected from light and moisture, the unmixed powder remains stable for up to 36 months.

  • Reconstitution: Utilize sterile bacteriostatic water.

    1. Allow the vial to reach ambient room temperature to prevent condensation.

    2. Introduce the diluent slowly, directing the fluid flow down the inner wall of the glass to prevent sheer stress.

    3. Do not agitate or vortex the vial. Allow the LL-37 5mg powder to dissolve naturally into a clear solution via gentle swirling.

    4. Once reconstituted, refrigerate immediately at 2°C to 8°C and utilize within standard laboratory protocol timelines.

Reviews

There are no reviews yet.

Be the first to review “LL-37 – 5mg Antimicrobial Peptide”

Your email address will not be published. Required fields are marked *

error: Content is protected !!
LL-37 5mgLL-37 – 5mg Antimicrobial Peptide
$45.00
- +
Scroll to Top